Anti FCHO2 pAb (ATL-HPA037685 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA037685-25

• 
• 

Protein Description: FCH domain only 2
Gene Name: FCHO2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041685: 97%, ENSRNOG00000015334: 99%
Entrez Gene ID: 115548
Uniprot ID: Q0JRZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIG
• Gene Sequence: KAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIG
• Gene ID - Mouse: ENSMUSG00000041685
• Gene ID - Rat: ENSRNOG00000015334
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.