Anti FCHO1 pAb (ATL-HPA041653)

Atlas Antibodies

SKU:
ATL-HPA041653-25
  • Immunohistochemical staining of human appendix shows strong cytoplasmic positivity in lymphoid tissue.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: FCH domain only 1
Gene Name: FCHO1
Alternative Gene Name: KIAA0290
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070000: 81%, ENSRNOG00000015334: 44%
Entrez Gene ID: 23149
Uniprot ID: O14526
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GAKAFRLPGLSRREREPEPPAAVDFLEPDSGTCPEVDEEGFTVRPDVTQNSTAEPSRFSSSDSDFDDEEPRKFYVHIKPA
Gene Sequence GAKAFRLPGLSRREREPEPPAAVDFLEPDSGTCPEVDEEGFTVRPDVTQNSTAEPSRFSSSDSDFDDEEPRKFYVHIKPA
Gene ID - Mouse ENSMUSG00000070000
Gene ID - Rat ENSRNOG00000015334
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FCHO1 pAb (ATL-HPA041653)
Datasheet Anti FCHO1 pAb (ATL-HPA041653) Datasheet (External Link)
Vendor Page Anti FCHO1 pAb (ATL-HPA041653) at Atlas Antibodies

Documents & Links for Anti FCHO1 pAb (ATL-HPA041653)
Datasheet Anti FCHO1 pAb (ATL-HPA041653) Datasheet (External Link)
Vendor Page Anti FCHO1 pAb (ATL-HPA041653)