Anti FCGRT pAb (ATL-HPA015130)

Atlas Antibodies

Catalog No.:
ATL-HPA015130-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: Fc fragment of IgG, receptor, transporter, alpha
Gene Name: FCGRT
Alternative Gene Name: alpha-chain, FCRN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003420: 73%, ENSRNOG00000020583: 69%
Entrez Gene ID: 2217
Uniprot ID: P55899
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLK
Gene Sequence LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLK
Gene ID - Mouse ENSMUSG00000003420
Gene ID - Rat ENSRNOG00000020583
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FCGRT pAb (ATL-HPA015130)
Datasheet Anti FCGRT pAb (ATL-HPA015130) Datasheet (External Link)
Vendor Page Anti FCGRT pAb (ATL-HPA015130) at Atlas Antibodies

Documents & Links for Anti FCGRT pAb (ATL-HPA015130)
Datasheet Anti FCGRT pAb (ATL-HPA015130) Datasheet (External Link)
Vendor Page Anti FCGRT pAb (ATL-HPA015130)