Anti FCGRT pAb (ATL-HPA015130)

Atlas Antibodies

SKU: ATL-HPA015130-25

• 

Protein Description: Fc fragment of IgG, receptor, transporter, alpha
Gene Name: FCGRT
Alternative Gene Name: alpha-chain, FCRN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003420: 73%, ENSRNOG00000020583: 69%
Entrez Gene ID: 2217
Uniprot ID: P55899
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLK
• Gene Sequence: LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLK
• Gene ID - Mouse: ENSMUSG00000003420
• Gene ID - Rat: ENSRNOG00000020583
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.