Anti FCGRT pAb (ATL-HPA015130)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015130-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FCGRT
Alternative Gene Name: alpha-chain, FCRN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003420: 73%, ENSRNOG00000020583: 69%
Entrez Gene ID: 2217
Uniprot ID: P55899
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLK |
Gene Sequence | LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLK |
Gene ID - Mouse | ENSMUSG00000003420 |
Gene ID - Rat | ENSRNOG00000020583 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FCGRT pAb (ATL-HPA015130) | |
Datasheet | Anti FCGRT pAb (ATL-HPA015130) Datasheet (External Link) |
Vendor Page | Anti FCGRT pAb (ATL-HPA015130) at Atlas Antibodies |
Documents & Links for Anti FCGRT pAb (ATL-HPA015130) | |
Datasheet | Anti FCGRT pAb (ATL-HPA015130) Datasheet (External Link) |
Vendor Page | Anti FCGRT pAb (ATL-HPA015130) |