Anti FCGRT pAb (ATL-HPA012122 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA012122-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: Fc fragment of IgG, receptor, transporter, alpha
Gene Name: FCGRT
Alternative Gene Name: alpha-chain, FCRN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003420: 72%, ENSRNOG00000020583: 73%
Entrez Gene ID: 2217
Uniprot ID: P55899
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKS
Gene Sequence LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKS
Gene ID - Mouse ENSMUSG00000003420
Gene ID - Rat ENSRNOG00000020583
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FCGRT pAb (ATL-HPA012122 w/enhanced validation)
Datasheet Anti FCGRT pAb (ATL-HPA012122 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FCGRT pAb (ATL-HPA012122 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FCGRT pAb (ATL-HPA012122 w/enhanced validation)
Datasheet Anti FCGRT pAb (ATL-HPA012122 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FCGRT pAb (ATL-HPA012122 w/enhanced validation)
Citations for Anti FCGRT pAb (ATL-HPA012122 w/enhanced validation) – 7 Found
Lozano, Natalia A; Lozano, Alejandro; Marini, Vanina; Saranz, Ricardo J; Blumberg, Richard S; Baker, Kristi; Agresta, Maria F; Ponzio, Marina F. Expression of FcRn receptor in placental tissue and its relationship with IgG levels in term and preterm newborns. American Journal Of Reproductive Immunology (New York, N.y. : 1989). 2018;80(3):e12972.  PubMed
Pannek, Andreas; Houghton, Fiona J; Verhagen, Anne M; Dower, Steven K; Hinde, Elizabeth; Gleeson, Paul A. Dynamics of intracellular neonatal Fc receptor-ligand interactions in primary macrophages using biophysical fluorescence techniques. Molecular Biology Of The Cell. 2022;33(1):ar6.  PubMed
Seijsing, Johan; Lindborg, Malin; Löfblom, John; Uhlén, Mathias; Gräslund, Torbjörn. Robust expression of the human neonatal Fc receptor in a truncated soluble form and as a full-length membrane-bound protein in fusion with eGFP. Plos One. 8(11):e81350.  PubMed
Baker, Kristi; Rath, Timo; Flak, Magdalena B; Arthur, Janelle C; Chen, Zhangguo; Glickman, Jonathan N; Zlobec, Inti; Karamitopoulou, Eva; Stachler, Matthew D; Odze, Robert D; Lencer, Wayne I; Jobin, Christian; Blumberg, Richard S. Neonatal Fc receptor expression in dendritic cells mediates protective immunity against colorectal cancer. Immunity. 2013;39(6):1095-107.  PubMed
Ko, Sung-Youl; Pegu, Amarendra; Rudicell, Rebecca S; Yang, Zhi-yong; Joyce, M Gordon; Chen, Xuejun; Wang, Keyun; Bao, Saran; Kraemer, Thomas D; Rath, Timo; Zeng, Ming; Schmidt, Stephen D; Todd, John-Paul; Penzak, Scott R; Saunders, Kevin O; Nason, Martha C; Haase, Ashley T; Rao, Srinivas S; Blumberg, Richard S; Mascola, John R; Nabel, Gary J. Enhanced neonatal Fc receptor function improves protection against primate SHIV infection. Nature. 2014;514(7524):642-5.  PubMed
Wu, Lin; Chen, Mingyu; Mao, Huijuan; Wang, Ningning; Zhang, Bo; Zhao, Xiufen; Qian, Jun; Xing, Changying. Albumin-based nanoparticles as methylprednisolone carriers for targeted delivery towards the neonatal Fc receptor in glomerular podocytes. International Journal Of Molecular Medicine. 2017;39(4):851-860.  PubMed
Alberio, Tiziana; Forlani, Greta; Lualdi, Marta; Tosi, Giovanna; Accolla, Roberto S; Fasano, Mauro. Neonatal Fc receptor is involved in the protection of fibrinogen after its intake in peripheral blood mononuclear cells. Journal Of Translational Medicine. 2018;16(1):64.  PubMed