Anti FCGR2A pAb (ATL-HPA010776)

Atlas Antibodies

SKU: ATL-HPA010776-25

• 

Protein Description: Fc fragment of IgG receptor IIa
Gene Name: FCGR2A
Alternative Gene Name: CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, IGFR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021010: 23%, ENSRNOG00000013747: 26%
Entrez Gene ID: 2212
Uniprot ID: P12318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
• Gene Sequence: RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
• Gene ID - Mouse: ENSMUSG00000021010
• Gene ID - Rat: ENSRNOG00000013747
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.