Anti FCGR2A pAb (ATL-HPA010718 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010718-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: FCGR2A
Alternative Gene Name: CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, IGFR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021010: 23%, ENSRNOG00000013747: 26%
Entrez Gene ID: 2212
Uniprot ID: P12318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN |
Gene Sequence | RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN |
Gene ID - Mouse | ENSMUSG00000021010 |
Gene ID - Rat | ENSRNOG00000013747 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FCGR2A pAb (ATL-HPA010718 w/enhanced validation) | |
Datasheet | Anti FCGR2A pAb (ATL-HPA010718 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FCGR2A pAb (ATL-HPA010718 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti FCGR2A pAb (ATL-HPA010718 w/enhanced validation) | |
Datasheet | Anti FCGR2A pAb (ATL-HPA010718 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FCGR2A pAb (ATL-HPA010718 w/enhanced validation) |
Citations for Anti FCGR2A pAb (ATL-HPA010718 w/enhanced validation) – 2 Found |
Jennings, Alison Ruth; Carroll, William M. Oligodendrocyte Lineage Cells in Chronic Demyelination of Multiple Sclerosis Optic Nerve. Brain Pathology (Zurich, Switzerland). 2015;25(5):517-30. PubMed |
Smith, Anthony J; Wietgrefe, Stephen W; Shang, Liang; Reilly, Cavan S; Southern, Peter J; Perkey, Katherine E; Duan, Lijie; Kohler, Heinz; Müller, Sybille; Robinson, James; Carlis, John V; Li, Qingsheng; Johnson, R Paul; Haase, Ashley T. Live simian immunodeficiency virus vaccine correlate of protection: immune complex-inhibitory Fc receptor interactions that reduce target cell availability. Journal Of Immunology (Baltimore, Md. : 1950). 2014;193(6):3126-33. PubMed |