Anti FCGBP pAb (ATL-HPA003564 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA003564-25
  • Immunohistochemistry analysis in human small intestine and liver tissues using HPA003564 antibody. Corresponding FCGBP RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: Fc fragment of IgG binding protein
Gene Name: FCGBP
Alternative Gene Name: FC(GAMMA)BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061022: 18%, ENSRNOG00000030714: 22%
Entrez Gene ID: 8857
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQAGDVVEFEVRPSWPLYLSANVGIQVLLFGTGAIRNEVTYDPYLVLIPDVAAYCPAYVVKSVPGCEGVALVVAQTKAISGLTIDGHAVGAKLTWEAVPGSEFSYAEVELGTADMIHTAEATTNLGLLT
Gene Sequence LQAGDVVEFEVRPSWPLYLSANVGIQVLLFGTGAIRNEVTYDPYLVLIPDVAAYCPAYVVKSVPGCEGVALVVAQTKAISGLTIDGHAVGAKLTWEAVPGSEFSYAEVELGTADMIHTAEATTNLGLLT
Gene ID - Mouse ENSMUSG00000061022
Gene ID - Rat ENSRNOG00000030714
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FCGBP pAb (ATL-HPA003564 w/enhanced validation)
Datasheet Anti FCGBP pAb (ATL-HPA003564 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FCGBP pAb (ATL-HPA003564 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FCGBP pAb (ATL-HPA003564 w/enhanced validation)
Datasheet Anti FCGBP pAb (ATL-HPA003564 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FCGBP pAb (ATL-HPA003564 w/enhanced validation)



Citations for Anti FCGBP pAb (ATL-HPA003564 w/enhanced validation) – 3 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed
Yuan, Ziming; Zhao, Zhixun; Hu, Hanqing; Zhu, Yihao; Zhang, Weiyuan; Tang, Qingchao; Huang, Rui; Gao, Feng; Zou, Chaoxia; Wang, Guiyu; Wang, Xishan. IgG Fc Binding Protein (FCGBP) is Down-Regulated in Metastatic Lesions and Predicts Survival in Metastatic Colorectal Cancer Patients. Oncotargets And Therapy. 14( 33603401):967-977.  PubMed
Weste, Jens; Houben, Till; Harder, Sönke; Schlüter, Hartmut; Lücke, Eva; Schreiber, Jens; Hoffmann, Werner. Different Molecular Forms of TFF3 in the Human Respiratory Tract: Heterodimerization with IgG Fc Binding Protein (FCGBP) and Proteolytic Cleavage in Bronchial Secretions. International Journal Of Molecular Sciences. 2022;23(23)  PubMed