Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA003517-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: Fc fragment of IgG binding protein
Gene Name: FCGBP
Alternative Gene Name: FC(GAMMA)BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047730: 82%, ENSRNOG00000019129: 80%
Entrez Gene ID: 8857
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GHRFDFQGTCEYLLSAPCHGPPLGAENFTVTVANEHRGSQAVSYTRSVTLQIYNHSLTLSARWPRKLQVDGVFVALPFQLDSLLHAHLSGADVVVTTTSGLSLAFDGDSF
Gene Sequence GHRFDFQGTCEYLLSAPCHGPPLGAENFTVTVANEHRGSQAVSYTRSVTLQIYNHSLTLSARWPRKLQVDGVFVALPFQLDSLLHAHLSGADVVVTTTSGLSLAFDGDSF
Gene ID - Mouse ENSMUSG00000047730
Gene ID - Rat ENSRNOG00000019129
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation)
Datasheet Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation)
Datasheet Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation)
Citations for Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation) – 3 Found
Fernández-Blanco, Joan Antoni; Fakih, Dalia; Arike, Liisa; Rodríguez-Piñeiro, Ana M; Martínez-Abad, Beatriz; Skansebo, Elin; Jackson, Sonya; Root, James; Singh, Dave; McCrae, Christopher; Evans, Christopher M; Åstrand, Annika; Ermund, Anna; Hansson, Gunnar C. Attached stratified mucus separates bacteria from the epithelial cells in COPD lungs. Jci Insight. 2018;3(17)  PubMed
Erickson, Nancy A; Nyström, Elisabeth E L; Mundhenk, Lars; Arike, Liisa; Glauben, Rainer; Heimesaat, Markus M; Fischer, André; Bereswill, Stefan; Birchenough, George M H; Gruber, Achim D; Johansson, Malin E V. The Goblet Cell Protein Clca1 (Alias mClca3 or Gob-5) Is Not Required for Intestinal Mucus Synthesis, Structure and Barrier Function in Naive or DSS-Challenged Mice. Plos One. 10(7):e0131991.  PubMed
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed