Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003517-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FCGBP
Alternative Gene Name: FC(GAMMA)BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047730: 82%, ENSRNOG00000019129: 80%
Entrez Gene ID: 8857
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GHRFDFQGTCEYLLSAPCHGPPLGAENFTVTVANEHRGSQAVSYTRSVTLQIYNHSLTLSARWPRKLQVDGVFVALPFQLDSLLHAHLSGADVVVTTTSGLSLAFDGDSF |
| Gene Sequence | GHRFDFQGTCEYLLSAPCHGPPLGAENFTVTVANEHRGSQAVSYTRSVTLQIYNHSLTLSARWPRKLQVDGVFVALPFQLDSLLHAHLSGADVVVTTTSGLSLAFDGDSF |
| Gene ID - Mouse | ENSMUSG00000047730 |
| Gene ID - Rat | ENSRNOG00000019129 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation) | |
| Datasheet | Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation) | |
| Datasheet | Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation) |
| Citations for Anti FCGBP pAb (ATL-HPA003517 w/enhanced validation) – 3 Found |
| Fernández-Blanco, Joan Antoni; Fakih, Dalia; Arike, Liisa; Rodríguez-Piñeiro, Ana M; Martínez-Abad, Beatriz; Skansebo, Elin; Jackson, Sonya; Root, James; Singh, Dave; McCrae, Christopher; Evans, Christopher M; Åstrand, Annika; Ermund, Anna; Hansson, Gunnar C. Attached stratified mucus separates bacteria from the epithelial cells in COPD lungs. Jci Insight. 2018;3(17) PubMed |
| Erickson, Nancy A; Nyström, Elisabeth E L; Mundhenk, Lars; Arike, Liisa; Glauben, Rainer; Heimesaat, Markus M; Fischer, André; Bereswill, Stefan; Birchenough, George M H; Gruber, Achim D; Johansson, Malin E V. The Goblet Cell Protein Clca1 (Alias mClca3 or Gob-5) Is Not Required for Intestinal Mucus Synthesis, Structure and Barrier Function in Naive or DSS-Challenged Mice. Plos One. 10(7):e0131991. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |