Anti FCF1 pAb (ATL-HPA046681)

Atlas Antibodies

Catalog No.:
ATL-HPA046681-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: FCF1 rRNA-processing protein
Gene Name: FCF1
Alternative Gene Name: Bka, C14orf111, CGI-35, UTP24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021243: 97%, ENSRNOG00000004723: 98%
Entrez Gene ID: 51077
Uniprot ID: Q9Y324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CITDCVMAEIEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMPDDYGAP
Gene Sequence CITDCVMAEIEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMPDDYGAP
Gene ID - Mouse ENSMUSG00000021243
Gene ID - Rat ENSRNOG00000004723
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FCF1 pAb (ATL-HPA046681)
Datasheet Anti FCF1 pAb (ATL-HPA046681) Datasheet (External Link)
Vendor Page Anti FCF1 pAb (ATL-HPA046681) at Atlas Antibodies

Documents & Links for Anti FCF1 pAb (ATL-HPA046681)
Datasheet Anti FCF1 pAb (ATL-HPA046681) Datasheet (External Link)
Vendor Page Anti FCF1 pAb (ATL-HPA046681)