Anti FCER1G pAb (ATL-HPA026872)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026872-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FCER1G
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058715: 85%, ENSRNOG00000024159: 88%
Entrez Gene ID: 2207
Uniprot ID: P30273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ |
Gene Sequence | KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ |
Gene ID - Mouse | ENSMUSG00000058715 |
Gene ID - Rat | ENSRNOG00000024159 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FCER1G pAb (ATL-HPA026872) | |
Datasheet | Anti FCER1G pAb (ATL-HPA026872) Datasheet (External Link) |
Vendor Page | Anti FCER1G pAb (ATL-HPA026872) at Atlas Antibodies |
Documents & Links for Anti FCER1G pAb (ATL-HPA026872) | |
Datasheet | Anti FCER1G pAb (ATL-HPA026872) Datasheet (External Link) |
Vendor Page | Anti FCER1G pAb (ATL-HPA026872) |