Anti FCER1G pAb (ATL-HPA026872)

Atlas Antibodies

SKU: ATL-HPA026872-25

• 

Protein Description: Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
Gene Name: FCER1G
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058715: 85%, ENSRNOG00000024159: 88%
Entrez Gene ID: 2207
Uniprot ID: P30273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
• Gene Sequence: KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
• Gene ID - Mouse: ENSMUSG00000058715
• Gene ID - Rat: ENSRNOG00000024159
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.