Anti FCER1A pAb (ATL-HPA036051)

Atlas Antibodies

Catalog No.: ATL-HPA036051-25

Protein Description: Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
Gene Name: FCER1A
Alternative Gene Name: FCE1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005339: 52%, ENSRNOG00000009177: 48%
Entrez Gene ID: 2205
Uniprot ID: P12319
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPL
• Gene Sequence: VSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPL
• Gene ID - Mouse: ENSMUSG00000005339
• Gene ID - Rat: ENSRNOG00000009177
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.