Anti FCER1A pAb (ATL-HPA036051)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036051-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FCER1A
Alternative Gene Name: FCE1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005339: 52%, ENSRNOG00000009177: 48%
Entrez Gene ID: 2205
Uniprot ID: P12319
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPL |
| Gene Sequence | VSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPL |
| Gene ID - Mouse | ENSMUSG00000005339 |
| Gene ID - Rat | ENSRNOG00000009177 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FCER1A pAb (ATL-HPA036051) | |
| Datasheet | Anti FCER1A pAb (ATL-HPA036051) Datasheet (External Link) |
| Vendor Page | Anti FCER1A pAb (ATL-HPA036051) at Atlas Antibodies |
| Documents & Links for Anti FCER1A pAb (ATL-HPA036051) | |
| Datasheet | Anti FCER1A pAb (ATL-HPA036051) Datasheet (External Link) |
| Vendor Page | Anti FCER1A pAb (ATL-HPA036051) |