Anti FBXW9 pAb (ATL-HPA042087)

Atlas Antibodies

Catalog No.:
ATL-HPA042087-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: F-box and WD repeat domain containing 9
Gene Name: FBXW9
Alternative Gene Name: Fbw9, MGC10870
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008167: 78%, ENSRNOG00000004212: 79%
Entrez Gene ID: 84261
Uniprot ID: Q5XUX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEEKNFDWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSVLLLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLI
Gene Sequence VEEKNFDWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSVLLLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLI
Gene ID - Mouse ENSMUSG00000008167
Gene ID - Rat ENSRNOG00000004212
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBXW9 pAb (ATL-HPA042087)
Datasheet Anti FBXW9 pAb (ATL-HPA042087) Datasheet (External Link)
Vendor Page Anti FBXW9 pAb (ATL-HPA042087) at Atlas Antibodies

Documents & Links for Anti FBXW9 pAb (ATL-HPA042087)
Datasheet Anti FBXW9 pAb (ATL-HPA042087) Datasheet (External Link)
Vendor Page Anti FBXW9 pAb (ATL-HPA042087)