Anti FBXW9 pAb (ATL-HPA042087)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042087-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FBXW9
Alternative Gene Name: Fbw9, MGC10870
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008167: 78%, ENSRNOG00000004212: 79%
Entrez Gene ID: 84261
Uniprot ID: Q5XUX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VEEKNFDWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSVLLLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLI |
| Gene Sequence | VEEKNFDWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSVLLLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLI |
| Gene ID - Mouse | ENSMUSG00000008167 |
| Gene ID - Rat | ENSRNOG00000004212 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FBXW9 pAb (ATL-HPA042087) | |
| Datasheet | Anti FBXW9 pAb (ATL-HPA042087) Datasheet (External Link) |
| Vendor Page | Anti FBXW9 pAb (ATL-HPA042087) at Atlas Antibodies |
| Documents & Links for Anti FBXW9 pAb (ATL-HPA042087) | |
| Datasheet | Anti FBXW9 pAb (ATL-HPA042087) Datasheet (External Link) |
| Vendor Page | Anti FBXW9 pAb (ATL-HPA042087) |