Anti FBXW9 pAb (ATL-HPA042087)

Atlas Antibodies

SKU: ATL-HPA042087-25

• 
• 

Protein Description: F-box and WD repeat domain containing 9
Gene Name: FBXW9
Alternative Gene Name: Fbw9, MGC10870
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008167: 78%, ENSRNOG00000004212: 79%
Entrez Gene ID: 84261
Uniprot ID: Q5XUX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEEKNFDWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSVLLLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLI
• Gene Sequence: VEEKNFDWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSVLLLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLI
• Gene ID - Mouse: ENSMUSG00000008167
• Gene ID - Rat: ENSRNOG00000004212
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.