Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038851-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FBXW8
Alternative Gene Name: FBW6, FBW8, FBX29, FBXO29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032867: 89%, ENSRNOG00000001126: 87%
Entrez Gene ID: 26259
Uniprot ID: Q8N3Y1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLIFQECRAKEHMLQTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAA |
Gene Sequence | KLIFQECRAKEHMLQTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAA |
Gene ID - Mouse | ENSMUSG00000032867 |
Gene ID - Rat | ENSRNOG00000001126 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation) | |
Datasheet | Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation) | |
Datasheet | Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation) |
Citations for Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation) – 2 Found |
Fahlbusch, Fabian B; Dawood, Yousif; Hartner, Andrea; Menendez-Castro, Carlos; Nögel, Stephanie C; Tzschoppe, Anja; Schneider, Holm; Strissel, Pamela; Beckmann, Matthias W; Schleussner, Ekkehard; Ruebner, Matthias; Dörr, Helmuth G; Schild, Ralf L; Rascher, Wolfgang; Dötsch, Jörg. Cullin 7 and Fbxw 8 expression in trophoblastic cells is regulated via oxygen tension: implications for intrauterine growth restriction?. The Journal Of Maternal-Fetal & Neonatal Medicine : The Official Journal Of The European Association Of Perinatal Medicine, The Federation Of Asia And Oceania Perinatal Societies, The International Society Of Perinatal Obstetricians. 2012;25(11):2209-15. PubMed |
Halbach, Melanie Vanessa; Stehning, Tanja; Damrath, Ewa; Jendrach, Marina; Şen, Nesli Ece; Başak, A Nazlı; Auburger, Georg. Both ubiquitin ligases FBXW8 and PARK2 are sequestrated into insolubility by ATXN2 PolyQ expansions, but only FBXW8 expression is dysregulated. Plos One. 10(3):e0121089. PubMed |