Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA038851-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: F-box and WD repeat domain containing 8
Gene Name: FBXW8
Alternative Gene Name: FBW6, FBW8, FBX29, FBXO29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032867: 89%, ENSRNOG00000001126: 87%
Entrez Gene ID: 26259
Uniprot ID: Q8N3Y1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLIFQECRAKEHMLQTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAA
Gene Sequence KLIFQECRAKEHMLQTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAA
Gene ID - Mouse ENSMUSG00000032867
Gene ID - Rat ENSRNOG00000001126
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation)
Datasheet Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation)
Datasheet Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation)
Citations for Anti FBXW8 pAb (ATL-HPA038851 w/enhanced validation) – 2 Found
Fahlbusch, Fabian B; Dawood, Yousif; Hartner, Andrea; Menendez-Castro, Carlos; Nögel, Stephanie C; Tzschoppe, Anja; Schneider, Holm; Strissel, Pamela; Beckmann, Matthias W; Schleussner, Ekkehard; Ruebner, Matthias; Dörr, Helmuth G; Schild, Ralf L; Rascher, Wolfgang; Dötsch, Jörg. Cullin 7 and Fbxw 8 expression in trophoblastic cells is regulated via oxygen tension: implications for intrauterine growth restriction?. The Journal Of Maternal-Fetal & Neonatal Medicine : The Official Journal Of The European Association Of Perinatal Medicine, The Federation Of Asia And Oceania Perinatal Societies, The International Society Of Perinatal Obstetricians. 2012;25(11):2209-15.  PubMed
Halbach, Melanie Vanessa; Stehning, Tanja; Damrath, Ewa; Jendrach, Marina; Şen, Nesli Ece; Başak, A Nazlı; Auburger, Georg. Both ubiquitin ligases FBXW8 and PARK2 are sequestrated into insolubility by ATXN2 PolyQ expansions, but only FBXW8 expression is dysregulated. Plos One. 10(3):e0121089.  PubMed