Anti FBXW8 pAb (ATL-HPA038850)

Atlas Antibodies

Catalog No.:
ATL-HPA038850-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: F-box and WD repeat domain containing 8
Gene Name: FBXW8
Alternative Gene Name: FBW6, FBW8, FBX29, FBXO29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032867: 78%, ENSRNOG00000001126: 77%
Entrez Gene ID: 26259
Uniprot ID: Q8N3Y1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDGFLNIWDLRTGKYPVHRFEHDARIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVAVAAAGDLMYLLKA
Gene Sequence EDGFLNIWDLRTGKYPVHRFEHDARIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVAVAAAGDLMYLLKA
Gene ID - Mouse ENSMUSG00000032867
Gene ID - Rat ENSRNOG00000001126
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBXW8 pAb (ATL-HPA038850)
Datasheet Anti FBXW8 pAb (ATL-HPA038850) Datasheet (External Link)
Vendor Page Anti FBXW8 pAb (ATL-HPA038850) at Atlas Antibodies

Documents & Links for Anti FBXW8 pAb (ATL-HPA038850)
Datasheet Anti FBXW8 pAb (ATL-HPA038850) Datasheet (External Link)
Vendor Page Anti FBXW8 pAb (ATL-HPA038850)