Anti FBXW5 pAb (ATL-HPA046615)

Atlas Antibodies

Catalog No.: ATL-HPA046615-25

Protein Description: F-box and WD repeat domain containing 5
Gene Name: FBXW5
Alternative Gene Name: DKFZP434B205, Fbw5, MGC20962
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015095: 96%, ENSRNOG00000028674: 96%
Entrez Gene ID: 54461
Uniprot ID: Q969U6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDNRYLYVNSRAWPNGAVVADPMQPPPIAEEIDLLVFDLKTMREVRRALRAHRAYTPNDECFFIFLDVSRDFVASGAEDRHGYIWDRHYNICLARLRHEDVVNSVVFSPQEQ
• Gene Sequence: PDNRYLYVNSRAWPNGAVVADPMQPPPIAEEIDLLVFDLKTMREVRRALRAHRAYTPNDECFFIFLDVSRDFVASGAEDRHGYIWDRHYNICLARLRHEDVVNSVVFSPQEQ
• Gene ID - Mouse: ENSMUSG00000015095
• Gene ID - Rat: ENSRNOG00000028674
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.