Anti FBXW5 pAb (ATL-HPA046615)

Atlas Antibodies

Catalog No.:
ATL-HPA046615-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: F-box and WD repeat domain containing 5
Gene Name: FBXW5
Alternative Gene Name: DKFZP434B205, Fbw5, MGC20962
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015095: 96%, ENSRNOG00000028674: 96%
Entrez Gene ID: 54461
Uniprot ID: Q969U6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDNRYLYVNSRAWPNGAVVADPMQPPPIAEEIDLLVFDLKTMREVRRALRAHRAYTPNDECFFIFLDVSRDFVASGAEDRHGYIWDRHYNICLARLRHEDVVNSVVFSPQEQ
Gene Sequence PDNRYLYVNSRAWPNGAVVADPMQPPPIAEEIDLLVFDLKTMREVRRALRAHRAYTPNDECFFIFLDVSRDFVASGAEDRHGYIWDRHYNICLARLRHEDVVNSVVFSPQEQ
Gene ID - Mouse ENSMUSG00000015095
Gene ID - Rat ENSRNOG00000028674
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBXW5 pAb (ATL-HPA046615)
Datasheet Anti FBXW5 pAb (ATL-HPA046615) Datasheet (External Link)
Vendor Page Anti FBXW5 pAb (ATL-HPA046615) at Atlas Antibodies

Documents & Links for Anti FBXW5 pAb (ATL-HPA046615)
Datasheet Anti FBXW5 pAb (ATL-HPA046615) Datasheet (External Link)
Vendor Page Anti FBXW5 pAb (ATL-HPA046615)