Anti FBXW4 pAb (ATL-HPA043496)

Atlas Antibodies

SKU:
ATL-HPA043496-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in smooth muscle cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
  • Western blot analysis in human cell line MCF-7.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: F-box and WD repeat domain containing 4
Gene Name: FBXW4
Alternative Gene Name: dactylin, Fbw4, SHFM3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040913: 97%, ENSRNOG00000046211: 95%
Entrez Gene ID: 6468
Uniprot ID: P57775
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGVLDVMYESPFTLLSCGYD
Gene Sequence QCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGVLDVMYESPFTLLSCGYD
Gene ID - Mouse ENSMUSG00000040913
Gene ID - Rat ENSRNOG00000046211
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FBXW4 pAb (ATL-HPA043496)
Datasheet Anti FBXW4 pAb (ATL-HPA043496) Datasheet (External Link)
Vendor Page Anti FBXW4 pAb (ATL-HPA043496) at Atlas Antibodies

Documents & Links for Anti FBXW4 pAb (ATL-HPA043496)
Datasheet Anti FBXW4 pAb (ATL-HPA043496) Datasheet (External Link)
Vendor Page Anti FBXW4 pAb (ATL-HPA043496)