Anti FBXW12 pAb (ATL-HPA037491)

Atlas Antibodies

Catalog No.: ATL-HPA037491-25

Protein Description: F-box and WD repeat domain containing 12
Gene Name: FBXW12
Alternative Gene Name: Fbw12, FBXO35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049314: 45%, ENSRNOG00000020720: 43%
Entrez Gene ID: 285231
Uniprot ID: Q6X9E4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PQVFLTESLLRPSEGSVPLSTFLPHKLCASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGA
• Gene Sequence: PQVFLTESLLRPSEGSVPLSTFLPHKLCASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGA
• Gene ID - Mouse: ENSMUSG00000049314
• Gene ID - Rat: ENSRNOG00000020720
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.