Anti FBXO7 pAb (ATL-HPA032114)

Atlas Antibodies

SKU: ATL-HPA032114-25

• 

Protein Description: F-box protein 7
Gene Name: FBXO7
Alternative Gene Name: Fbx, FBX7, PARK15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001786: 78%, ENSRNOG00000004637: 81%
Entrez Gene ID: 25793
Uniprot ID: Q9Y3I1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYK
• Gene Sequence: EGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYK
• Gene ID - Mouse: ENSMUSG00000001786
• Gene ID - Rat: ENSRNOG00000004637
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FBXO7 pAb (ATL-HPA032114) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.