Anti FBXO5 pAb (ATL-HPA029048)

Atlas Antibodies

SKU:
ATL-HPA029048-25
  • Immunohistochemical staining of human Bone marrow shows moderate nuclear positivity in hematopoietic cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
  • Western blot analysis in human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: F-box protein 5
Gene Name: FBXO5
Alternative Gene Name: EMI1, FBX5, Fbxo31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019773: 77%, ENSRNOG00000024077: 72%
Entrez Gene ID: 26271
Uniprot ID: Q9UKT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EENFGDSLQSCLLQIQSPDQYPNKNLLPVLHFEKVVCSTLKKNAKRNPKVDREMLKEIIARGNFRLQNIIGRKMGLECVDILSELFRRGLR
Gene Sequence EENFGDSLQSCLLQIQSPDQYPNKNLLPVLHFEKVVCSTLKKNAKRNPKVDREMLKEIIARGNFRLQNIIGRKMGLECVDILSELFRRGLR
Gene ID - Mouse ENSMUSG00000019773
Gene ID - Rat ENSRNOG00000024077
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FBXO5 pAb (ATL-HPA029048)
Datasheet Anti FBXO5 pAb (ATL-HPA029048) Datasheet (External Link)
Vendor Page Anti FBXO5 pAb (ATL-HPA029048) at Atlas Antibodies

Documents & Links for Anti FBXO5 pAb (ATL-HPA029048)
Datasheet Anti FBXO5 pAb (ATL-HPA029048) Datasheet (External Link)
Vendor Page Anti FBXO5 pAb (ATL-HPA029048)