Anti FBXO44 pAb (ATL-HPA003363)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003363-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FBXO44
Alternative Gene Name: FBG3, FBX30, Fbx44, Fbxo6a, MGC14140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029001: 83%, ENSRNOG00000009298: 45%
Entrez Gene ID: 93611
Uniprot ID: Q9H4M3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVRSQARLRVQVPAVRSAPVVRARASGDLPARPGDHPAEERCQVEGGLPHILQLP |
| Gene Sequence | SLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVRSQARLRVQVPAVRSAPVVRARASGDLPARPGDHPAEERCQVEGGLPHILQLP |
| Gene ID - Mouse | ENSMUSG00000029001 |
| Gene ID - Rat | ENSRNOG00000009298 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FBXO44 pAb (ATL-HPA003363) | |
| Datasheet | Anti FBXO44 pAb (ATL-HPA003363) Datasheet (External Link) |
| Vendor Page | Anti FBXO44 pAb (ATL-HPA003363) at Atlas Antibodies |
| Documents & Links for Anti FBXO44 pAb (ATL-HPA003363) | |
| Datasheet | Anti FBXO44 pAb (ATL-HPA003363) Datasheet (External Link) |
| Vendor Page | Anti FBXO44 pAb (ATL-HPA003363) |
| Citations for Anti FBXO44 pAb (ATL-HPA003363) – 3 Found |
| Lu, Yunzhe; Li, Jiezhi; Cheng, Dongmei; Parameswaran, Balaji; Zhang, Shaohua; Jiang, Zefei; Yew, P Renee; Peng, Junmin; Ye, Qinong; Hu, Yanfen. The F-box protein FBXO44 mediates BRCA1 ubiquitination and degradation. The Journal Of Biological Chemistry. 2012;287(49):41014-22. PubMed |
| Sjögren, Benita; Swaney, Steven; Neubig, Richard R. FBXO44-Mediated Degradation of RGS2 Protein Uniquely Depends on a Cullin 4B/DDB1 Complex. Plos One. 10(5):e0123581. PubMed |
| Shen, Jia Z; Qiu, Zhixin; Wu, Qiulian; Finlay, Darren; Garcia, Guillermina; Sun, Dahui; Rantala, Juha; Barshop, William; Hope, Jennifer L; Gimple, Ryan C; Sangfelt, Olle; Bradley, Linda M; Wohlschlegel, James; Rich, Jeremy N; Spruck, Charles. FBXO44 promotes DNA replication-coupled repetitive element silencing in cancer cells. Cell. 2021;184(2):352-369.e23. PubMed |