Anti FBXO43 pAb (ATL-HPA024295)

Atlas Antibodies

Catalog No.:
ATL-HPA024295-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: F-box protein 43
Gene Name: FBXO43
Alternative Gene Name: Fbx43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048230: 55%, ENSRNOG00000010459: 59%
Entrez Gene ID: 286151
Uniprot ID: Q4G163
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGTPKVGDTIRKTRHLGRSRRLSTLREQSSQSETEEEKQIVHPDSEKRAAAASAISEGQLSSDESGDLTFSLKNLSKTPALQLVHELFMKSKRKRLQEVD
Gene Sequence KGTPKVGDTIRKTRHLGRSRRLSTLREQSSQSETEEEKQIVHPDSEKRAAAASAISEGQLSSDESGDLTFSLKNLSKTPALQLVHELFMKSKRKRLQEVD
Gene ID - Mouse ENSMUSG00000048230
Gene ID - Rat ENSRNOG00000010459
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBXO43 pAb (ATL-HPA024295)
Datasheet Anti FBXO43 pAb (ATL-HPA024295) Datasheet (External Link)
Vendor Page Anti FBXO43 pAb (ATL-HPA024295) at Atlas Antibodies

Documents & Links for Anti FBXO43 pAb (ATL-HPA024295)
Datasheet Anti FBXO43 pAb (ATL-HPA024295) Datasheet (External Link)
Vendor Page Anti FBXO43 pAb (ATL-HPA024295)