Anti FBXO38 pAb (ATL-HPA041444)

Atlas Antibodies

SKU: ATL-HPA041444-25

• 

Protein Description: F-box protein 38
Gene Name: FBXO38
Alternative Gene Name: Fbx38, FLJ13962, MOKA, SP329
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042211: 81%, ENSRNOG00000019063: 84%
Entrez Gene ID: 81545
Uniprot ID: Q6PIJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEENDFRQDLQPGEQQFAADALNEMEDIVQEDGEVVAESGNNTPAHSQAIIPVDVDEEQAGPSGLQRVVKPTSITVHDSESDDEEDSLELQEVWIPKN
• Gene Sequence: DEENDFRQDLQPGEQQFAADALNEMEDIVQEDGEVVAESGNNTPAHSQAIIPVDVDEEQAGPSGLQRVVKPTSITVHDSESDDEEDSLELQEVWIPKN
• Gene ID - Mouse: ENSMUSG00000042211
• Gene ID - Rat: ENSRNOG00000019063
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.