Anti FBXO38 pAb (ATL-HPA034821)
Atlas Antibodies
- SKU:
- ATL-HPA034821-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FBXO38
Alternative Gene Name: Fbx38, FLJ13962, MOKA, SP329
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042211: 96%, ENSRNOG00000019063: 99%
Entrez Gene ID: 81545
Uniprot ID: Q6PIJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YTLEGVVDGAPYSMISDFPWLRSLRAAEPNSFARYDFEDDEESTIYAPRRKGQLSADICMETIGEEISEMRQMKKGVFQRVVA |
Gene Sequence | YTLEGVVDGAPYSMISDFPWLRSLRAAEPNSFARYDFEDDEESTIYAPRRKGQLSADICMETIGEEISEMRQMKKGVFQRVVA |
Gene ID - Mouse | ENSMUSG00000042211 |
Gene ID - Rat | ENSRNOG00000019063 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FBXO38 pAb (ATL-HPA034821) | |
Datasheet | Anti FBXO38 pAb (ATL-HPA034821) Datasheet (External Link) |
Vendor Page | Anti FBXO38 pAb (ATL-HPA034821) at Atlas Antibodies |
Documents & Links for Anti FBXO38 pAb (ATL-HPA034821) | |
Datasheet | Anti FBXO38 pAb (ATL-HPA034821) Datasheet (External Link) |
Vendor Page | Anti FBXO38 pAb (ATL-HPA034821) |