Anti FBXL8 pAb (ATL-HPA035588)

Atlas Antibodies

SKU: ATL-HPA035588-25

• 
• 

Protein Description: F-box and leucine-rich repeat protein 8
Gene Name: FBXL8
Alternative Gene Name: Fbl8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033313: 81%, ENSRNOG00000015242: 79%
Entrez Gene ID: 55336
Uniprot ID: Q96CD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATL
• Gene Sequence: SHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATL
• Gene ID - Mouse: ENSMUSG00000033313
• Gene ID - Rat: ENSRNOG00000015242
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.