Anti FBXL8 pAb (ATL-HPA035588)

Atlas Antibodies

Catalog No.:
ATL-HPA035588-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: F-box and leucine-rich repeat protein 8
Gene Name: FBXL8
Alternative Gene Name: Fbl8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033313: 81%, ENSRNOG00000015242: 79%
Entrez Gene ID: 55336
Uniprot ID: Q96CD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATL
Gene Sequence SHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATL
Gene ID - Mouse ENSMUSG00000033313
Gene ID - Rat ENSRNOG00000015242
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBXL8 pAb (ATL-HPA035588)
Datasheet Anti FBXL8 pAb (ATL-HPA035588) Datasheet (External Link)
Vendor Page Anti FBXL8 pAb (ATL-HPA035588) at Atlas Antibodies

Documents & Links for Anti FBXL8 pAb (ATL-HPA035588)
Datasheet Anti FBXL8 pAb (ATL-HPA035588) Datasheet (External Link)
Vendor Page Anti FBXL8 pAb (ATL-HPA035588)