Anti FBXL4 pAb (ATL-HPA029140)

Atlas Antibodies

Catalog No.: ATL-HPA029140-25

Protein Description: F-box and leucine-rich repeat protein 4
Gene Name: FBXL4
Alternative Gene Name: FBL4, FBL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040410: 94%, ENSRNOG00000005641: 93%
Entrez Gene ID: 26235
Uniprot ID: Q9UKA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATRGEMMNTHRAIESNSQTSPLNAEVVQYAKEVVDFSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSA
• Gene Sequence: ATRGEMMNTHRAIESNSQTSPLNAEVVQYAKEVVDFSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSA
• Gene ID - Mouse: ENSMUSG00000040410
• Gene ID - Rat: ENSRNOG00000005641
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.