Anti FBXL4 pAb (ATL-HPA029140)

Atlas Antibodies

Catalog No.:
ATL-HPA029140-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: F-box and leucine-rich repeat protein 4
Gene Name: FBXL4
Alternative Gene Name: FBL4, FBL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040410: 94%, ENSRNOG00000005641: 93%
Entrez Gene ID: 26235
Uniprot ID: Q9UKA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATRGEMMNTHRAIESNSQTSPLNAEVVQYAKEVVDFSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSA
Gene Sequence ATRGEMMNTHRAIESNSQTSPLNAEVVQYAKEVVDFSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSA
Gene ID - Mouse ENSMUSG00000040410
Gene ID - Rat ENSRNOG00000005641
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBXL4 pAb (ATL-HPA029140)
Datasheet Anti FBXL4 pAb (ATL-HPA029140) Datasheet (External Link)
Vendor Page Anti FBXL4 pAb (ATL-HPA029140) at Atlas Antibodies

Documents & Links for Anti FBXL4 pAb (ATL-HPA029140)
Datasheet Anti FBXL4 pAb (ATL-HPA029140) Datasheet (External Link)
Vendor Page Anti FBXL4 pAb (ATL-HPA029140)