Anti FBXL4 pAb (ATL-HPA029140)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029140-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FBXL4
Alternative Gene Name: FBL4, FBL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040410: 94%, ENSRNOG00000005641: 93%
Entrez Gene ID: 26235
Uniprot ID: Q9UKA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATRGEMMNTHRAIESNSQTSPLNAEVVQYAKEVVDFSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSA |
Gene Sequence | ATRGEMMNTHRAIESNSQTSPLNAEVVQYAKEVVDFSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSA |
Gene ID - Mouse | ENSMUSG00000040410 |
Gene ID - Rat | ENSRNOG00000005641 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FBXL4 pAb (ATL-HPA029140) | |
Datasheet | Anti FBXL4 pAb (ATL-HPA029140) Datasheet (External Link) |
Vendor Page | Anti FBXL4 pAb (ATL-HPA029140) at Atlas Antibodies |
Documents & Links for Anti FBXL4 pAb (ATL-HPA029140) | |
Datasheet | Anti FBXL4 pAb (ATL-HPA029140) Datasheet (External Link) |
Vendor Page | Anti FBXL4 pAb (ATL-HPA029140) |