Anti FBXL19 pAb (ATL-HPA035317)

Atlas Antibodies

SKU: ATL-HPA035317-25

• 

Protein Description: F-box and leucine-rich repeat protein 19
Gene Name: FBXL19
Alternative Gene Name: CXXC11, DKFZp434K0410, Fbl19, JHDM1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030811: 100%, ENSRNOG00000018986: 100%
Entrez Gene ID: 54620
Uniprot ID: Q6PCT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGVSKKQLMWLLNRLQGLQELVLSGCSWLSVSALGSAPLPALRLLDLRWIEDVKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLSALDLSHCAHVGDPSVHLLT
• Gene Sequence: TGVSKKQLMWLLNRLQGLQELVLSGCSWLSVSALGSAPLPALRLLDLRWIEDVKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLSALDLSHCAHVGDPSVHLLT
• Gene ID - Mouse: ENSMUSG00000030811
• Gene ID - Rat: ENSRNOG00000018986
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.