Anti FBXL17 pAb (ATL-HPA036410)

Atlas Antibodies

Catalog No.:
ATL-HPA036410-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: F-box and leucine-rich repeat protein 17
Gene Name: FBXL17
Alternative Gene Name: DKFZP434C1715, Fbl17, Fbx13, FBXO13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023965: 96%, ENSRNOG00000013875: 99%
Entrez Gene ID: 64839
Uniprot ID: Q9UF56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSDNGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYK
Gene Sequence MSDNGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYK
Gene ID - Mouse ENSMUSG00000023965
Gene ID - Rat ENSRNOG00000013875
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBXL17 pAb (ATL-HPA036410)
Datasheet Anti FBXL17 pAb (ATL-HPA036410) Datasheet (External Link)
Vendor Page Anti FBXL17 pAb (ATL-HPA036410) at Atlas Antibodies

Documents & Links for Anti FBXL17 pAb (ATL-HPA036410)
Datasheet Anti FBXL17 pAb (ATL-HPA036410) Datasheet (External Link)
Vendor Page Anti FBXL17 pAb (ATL-HPA036410)