Anti FBXL16 pAb (ATL-HPA039504 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA039504-100
  • Immunohistochemical staining of human caudate nucleus shows strong cytoplasmic positivity in neurons.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Cerebral Cortex tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: F-box and leucine-rich repeat protein 16
Gene Name: FBXL16
Alternative Gene Name: C16orf22, Fbl16, MGC33974
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025738: 98%, ENSRNOG00000022248: 98%
Entrez Gene ID: 146330
Uniprot ID: Q8N461
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKA
Gene Sequence ILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKA
Gene ID - Mouse ENSMUSG00000025738
Gene ID - Rat ENSRNOG00000022248
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FBXL16 pAb (ATL-HPA039504 w/enhanced validation)
Datasheet Anti FBXL16 pAb (ATL-HPA039504 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FBXL16 pAb (ATL-HPA039504 w/enhanced validation)