Anti FBXL12 pAb (ATL-HPA002843)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002843-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FBXL12
Alternative Gene Name: Fbl12, FLJ20188
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066892: 90%, ENSRNOG00000020368: 88%
Entrez Gene ID: 54850
Uniprot ID: Q9NXK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRAC |
Gene Sequence | VLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRAC |
Gene ID - Mouse | ENSMUSG00000066892 |
Gene ID - Rat | ENSRNOG00000020368 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FBXL12 pAb (ATL-HPA002843) | |
Datasheet | Anti FBXL12 pAb (ATL-HPA002843) Datasheet (External Link) |
Vendor Page | Anti FBXL12 pAb (ATL-HPA002843) at Atlas Antibodies |
Documents & Links for Anti FBXL12 pAb (ATL-HPA002843) | |
Datasheet | Anti FBXL12 pAb (ATL-HPA002843) Datasheet (External Link) |
Vendor Page | Anti FBXL12 pAb (ATL-HPA002843) |