Anti FBXL12 pAb (ATL-HPA002843)

Atlas Antibodies

Catalog No.: ATL-HPA002843-25

Protein Description: F-box and leucine-rich repeat protein 12
Gene Name: FBXL12
Alternative Gene Name: Fbl12, FLJ20188
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066892: 90%, ENSRNOG00000020368: 88%
Entrez Gene ID: 54850
Uniprot ID: Q9NXK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRAC
• Gene Sequence: VLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRAC
• Gene ID - Mouse: ENSMUSG00000066892
• Gene ID - Rat: ENSRNOG00000020368
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.