Anti FBXL12 pAb (ATL-HPA002843)

Atlas Antibodies

Catalog No.:
ATL-HPA002843-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: F-box and leucine-rich repeat protein 12
Gene Name: FBXL12
Alternative Gene Name: Fbl12, FLJ20188
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066892: 90%, ENSRNOG00000020368: 88%
Entrez Gene ID: 54850
Uniprot ID: Q9NXK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRAC
Gene Sequence VLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRAC
Gene ID - Mouse ENSMUSG00000066892
Gene ID - Rat ENSRNOG00000020368
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBXL12 pAb (ATL-HPA002843)
Datasheet Anti FBXL12 pAb (ATL-HPA002843) Datasheet (External Link)
Vendor Page Anti FBXL12 pAb (ATL-HPA002843) at Atlas Antibodies

Documents & Links for Anti FBXL12 pAb (ATL-HPA002843)
Datasheet Anti FBXL12 pAb (ATL-HPA002843) Datasheet (External Link)
Vendor Page Anti FBXL12 pAb (ATL-HPA002843)