Anti FBRS pAb (ATL-HPA044117)

Atlas Antibodies

SKU:
ATL-HPA044117-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: fibrosin
Gene Name: FBRS
Alternative Gene Name: FBS, FBS1, FLJ11618
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042423: 99%, ENSRNOG00000042728: 99%
Entrez Gene ID: 64319
Uniprot ID: Q9HAH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LRHQEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASLFTATGAVHAAANPFTAAPGAHGPFLSPSTH
Gene Sequence LRHQEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASLFTATGAVHAAANPFTAAPGAHGPFLSPSTH
Gene ID - Mouse ENSMUSG00000042423
Gene ID - Rat ENSRNOG00000042728
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FBRS pAb (ATL-HPA044117)
Datasheet Anti FBRS pAb (ATL-HPA044117) Datasheet (External Link)
Vendor Page Anti FBRS pAb (ATL-HPA044117) at Atlas Antibodies

Documents & Links for Anti FBRS pAb (ATL-HPA044117)
Datasheet Anti FBRS pAb (ATL-HPA044117) Datasheet (External Link)
Vendor Page Anti FBRS pAb (ATL-HPA044117)