Anti FBRS pAb (ATL-HPA044117)
Atlas Antibodies
- SKU:
- ATL-HPA044117-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FBRS
Alternative Gene Name: FBS, FBS1, FLJ11618
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042423: 99%, ENSRNOG00000042728: 99%
Entrez Gene ID: 64319
Uniprot ID: Q9HAH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LRHQEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASLFTATGAVHAAANPFTAAPGAHGPFLSPSTH |
Gene Sequence | LRHQEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASLFTATGAVHAAANPFTAAPGAHGPFLSPSTH |
Gene ID - Mouse | ENSMUSG00000042423 |
Gene ID - Rat | ENSRNOG00000042728 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FBRS pAb (ATL-HPA044117) | |
Datasheet | Anti FBRS pAb (ATL-HPA044117) Datasheet (External Link) |
Vendor Page | Anti FBRS pAb (ATL-HPA044117) at Atlas Antibodies |
Documents & Links for Anti FBRS pAb (ATL-HPA044117) | |
Datasheet | Anti FBRS pAb (ATL-HPA044117) Datasheet (External Link) |
Vendor Page | Anti FBRS pAb (ATL-HPA044117) |