Anti FBLN7 pAb (ATL-HPA034992)

Atlas Antibodies

SKU:
ATL-HPA034992-25
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cell junctions.
  • Western blot analysis in human cell line U-2197.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: fibulin 7
Gene Name: FBLN7
Alternative Gene Name: FLJ37440, TM14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027386: 79%, ENSRNOG00000017550: 75%
Entrez Gene ID: 129804
Uniprot ID: Q53RD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKSRLAALQNSVGRVGPDALPVSCPALNTPADGRKFGSKYLVDHE
Gene Sequence ASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKSRLAALQNSVGRVGPDALPVSCPALNTPADGRKFGSKYLVDHE
Gene ID - Mouse ENSMUSG00000027386
Gene ID - Rat ENSRNOG00000017550
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FBLN7 pAb (ATL-HPA034992)
Datasheet Anti FBLN7 pAb (ATL-HPA034992) Datasheet (External Link)
Vendor Page Anti FBLN7 pAb (ATL-HPA034992) at Atlas Antibodies

Documents & Links for Anti FBLN7 pAb (ATL-HPA034992)
Datasheet Anti FBLN7 pAb (ATL-HPA034992) Datasheet (External Link)
Vendor Page Anti FBLN7 pAb (ATL-HPA034992)