Anti FBF1 pAb (ATL-HPA023677)

Atlas Antibodies

SKU: ATL-HPA023677-25

• 
• 

Protein Description: Fas (TNFRSF6) binding factor 1
Gene Name: FBF1
Alternative Gene Name: ALB, FBF-1, FLJ00103, KIAA1863
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020776: 44%, ENSRNOG00000008577: 44%
Entrez Gene ID: 85302
Uniprot ID: Q8TES7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARTKSLLGDDVFSTMAGLEEADAEVSGISEADPQALLQAMKDLDGMDADILGLKKSNSAPSKKAAKDPGKGELPNHP
• Gene Sequence: ARTKSLLGDDVFSTMAGLEEADAEVSGISEADPQALLQAMKDLDGMDADILGLKKSNSAPSKKAAKDPGKGELPNHP
• Gene ID - Mouse: ENSMUSG00000020776
• Gene ID - Rat: ENSRNOG00000008577
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FBF1 pAb (ATL-HPA023677) – 10 Found

Airik, Rannar; Schueler, Markus; Airik, Merlin; Cho, Jang; Ulanowicz, Kelsey A; Porath, Jonathan D; Hurd, Toby W; Bekker-Jensen, Simon; Schrøder, Jacob M; Andersen, Jens S; Hildebrandt, Friedhelm. SDCCAG8 Interacts with RAB Effector Proteins RABEP2 and ERC1 and Is Required for Hedgehog Signaling. Plos One. 11(5):e0156081. 

Kanie, Tomoharu; Abbott, Keene Louis; Mooney, Nancie Ann; Plowey, Edward Douglas; Demeter, Janos; Jackson, Peter Kent. The CEP19-RABL2 GTPase Complex Binds IFT-B to Initiate Intraflagellar Transport at the Ciliary Base. Developmental Cell. 2017;42(1):22-36.e12. 

Tu, Hai-Qing; Qin, Xuan-He; Liu, Zhi-Bin; Song, Zeng-Qing; Hu, Huai-Bin; Zhang, Yu-Cheng; Chang, Yan; Wu, Min; Huang, Yan; Bai, Yun-Feng; Wang, Guang; Han, Qiu-Ying; Li, Ai-Ling; Zhou, Tao; Liu, Feng; Zhang, Xue-Min; Li, Hui-Yan. Microtubule asters anchored by FSD1 control axoneme assembly and ciliogenesis. Nature Communications. 2018;9(1):5277. 

Jakobsen, Lis; Vanselow, Katja; Skogs, Marie; Toyoda, Yusuke; Lundberg, Emma; Poser, Ina; Falkenby, Lasse G; Bennetzen, Martin; Westendorf, Jens; Nigg, Erich A; Uhlen, Mathias; Hyman, Anthony A; Andersen, Jens S. Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods. The Embo Journal. 2011;30(8):1520-35. 

Jodoin, Jeanne N; Shboul, Mohammad; Albrecht, Todd R; Lee, Ethan; Wagner, Eric J; Reversade, Bruno; Lee, Laura A. The snRNA-processing complex, Integrator, is required for ciliogenesis and dynein recruitment to the nuclear envelope via distinct mechanisms. Biology Open. 2013;2(12):1390-6. 

Kong, Dong; Farmer, Veronica; Shukla, Anil; James, Jana; Gruskin, Richard; Kiriyama, Shigeo; Loncarek, Jadranka. Centriole maturation requires regulated Plk1 activity during two consecutive cell cycles. The Journal Of Cell Biology. 2014;206(7):855-65. 

Sahabandu, N; Kong, D; Magidson, V; Nanjundappa, R; Sullenberger, C; Mahjoub, M R; Loncarek, J. Expansion microscopy for the analysis of centrioles and cilia. Journal Of Microscopy. 2019;276(3):145-159. 

Viol, Linda; Hata, Shoji; Pastor-Peidro, Ana; Neuner, Annett; Murke, Florian; Wuchter, Patrick; Ho, Anthony D; Giebel, Bernd; Pereira, Gislene. Nek2 kinase displaces distal appendages from the mother centriole prior to mitosis. The Journal Of Cell Biology. 2020;219(3) 

Shen, Xiao-Lin; Yuan, Jin-Feng; Qin, Xuan-He; Song, Guang-Ping; Hu, Huai-Bin; Tu, Hai-Qing; Song, Zeng-Qing; Li, Pei-Yao; Xu, Yu-Ling; Li, Sen; Jian, Xiao-Xiao; Li, Jia-Ning; He, Chun-Yu; Yu, Xi-Ping; Liang, Li-Yun; Wu, Min; Han, Qiu-Ying; Wang, Kai; Li, Ai-Ling; Zhou, Tao; Zhang, Yu-Cheng; Wang, Na; Li, Hui-Yan. LUBAC regulates ciliogenesis by promoting CP110 removal from the mother centriole. The Journal Of Cell Biology. 2022;221(1) 

Magistrati, Elisa; Maestrini, Giorgia; Niño, Carlos A; Lince-Faria, Mariana; Beznoussenko, Galina; Mironov, Alexandre; Maspero, Elena; Bettencourt-Dias, Mónica; Polo, Simona. Myosin VI regulates ciliogenesis by promoting the turnover of the centrosomal/satellite protein OFD1. Embo Reports. 2022;23(3):e54160.