Anti FAXC pAb (ATL-HPA039106)

Atlas Antibodies

SKU:
ATL-HPA039106-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: failed axon connections homolog (Drosophila)
Gene Name: FAXC
Alternative Gene Name: C6orf168, dJ273F20, MGC2817
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028246: 100%, ENSRNOG00000010106: 100%
Entrez Gene ID: 84553
Uniprot ID: Q5TGI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen HFYWTLAYCQWVDNLNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLG
Gene Sequence HFYWTLAYCQWVDNLNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLG
Gene ID - Mouse ENSMUSG00000028246
Gene ID - Rat ENSRNOG00000010106
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAXC pAb (ATL-HPA039106)
Datasheet Anti FAXC pAb (ATL-HPA039106) Datasheet (External Link)
Vendor Page Anti FAXC pAb (ATL-HPA039106) at Atlas Antibodies

Documents & Links for Anti FAXC pAb (ATL-HPA039106)
Datasheet Anti FAXC pAb (ATL-HPA039106) Datasheet (External Link)
Vendor Page Anti FAXC pAb (ATL-HPA039106)