Anti FAS pAb (ATL-HPA027444 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA027444-25

• 
• 
• 

Protein Description: Fas cell surface death receptor
Gene Name: FAS
Alternative Gene Name: APO-1, APT1, CD95, FAS1, TNFRSF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024778: 48%, ENSRNOG00000019142: 52%
Entrez Gene ID: 355
Uniprot ID: P25445
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH
• Gene Sequence: QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH
• Gene ID - Mouse: ENSMUSG00000024778
• Gene ID - Rat: ENSRNOG00000019142
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAS pAb (ATL-HPA027444 w/enhanced validation) – 3 Found

Hashiramoto, Akira; Konishi, Yoshitake; Murayama, Koichi; Kawasaki, Hiroki; Yoshida, Kohsuke; Tsumiyama, Ken; Tanaka, Kimie; Mizuhara, Masaru; Shiotsuki, Toshio; Kitamura, Hitomi; Komai, Koichiro; Kimura, Tomoatsu; Yagita, Hideo; Shiozawa, Kazuko; Shiozawa, Shunichi. A variant of death-receptor 3 associated with rheumatoid arthritis interferes with apoptosis-induction of T cell. The Journal Of Biological Chemistry. 2018;293(6):1933-1943. 

Fransen, Nina L; Crusius, Jakob B A; Smolders, Joost; Mizee, Mark R; van Eden, Corbert G; Luchetti, Sabina; Remmerswaal, Ester B M; Hamann, Jörg; Mason, Matthew R J; Huitinga, Inge. Post-mortem multiple sclerosis lesion pathology is influenced by single nucleotide polymorphisms. Brain Pathology (Zurich, Switzerland). 2020;30(1):106-119. 

Zhao, Liang; Cheng, Zhe; Lu, Zhiyue; Jin, Jianqiu. NAD-dependent methylenetetrahydrofolate dehydrogenase inhibits oral squamous cell carcinoma cell proliferation and promotes apoptosis. Translational Cancer Research. 2021;10(3):1457-1469.