Anti FARSB pAb (ATL-HPA036677)

Atlas Antibodies

SKU: ATL-HPA036677-25

• 

Protein Description: phenylalanyl-tRNA synthetase, beta subunit
Gene Name: FARSB
Alternative Gene Name: FARSLB, FRSB, PheHB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026245: 92%, ENSRNOG00000014119: 95%
Entrez Gene ID: 10056
Uniprot ID: Q9NSD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKEQGNVKAAGASDVVLYKIDVPANRYDLLCLEGLVRGLQVFKERIKAPVYKRVMPDGKIQKLIITEETAKIRPFAVAAVLRNIKFTKDRYDSFIELQEKL
• Gene Sequence: SKEQGNVKAAGASDVVLYKIDVPANRYDLLCLEGLVRGLQVFKERIKAPVYKRVMPDGKIQKLIITEETAKIRPFAVAAVLRNIKFTKDRYDSFIELQEKL
• Gene ID - Mouse: ENSMUSG00000026245
• Gene ID - Rat: ENSRNOG00000014119
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.