Anti FARSB pAb (ATL-HPA036677)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036677-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FARSB
Alternative Gene Name: FARSLB, FRSB, PheHB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026245: 92%, ENSRNOG00000014119: 95%
Entrez Gene ID: 10056
Uniprot ID: Q9NSD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SKEQGNVKAAGASDVVLYKIDVPANRYDLLCLEGLVRGLQVFKERIKAPVYKRVMPDGKIQKLIITEETAKIRPFAVAAVLRNIKFTKDRYDSFIELQEKL |
Gene Sequence | SKEQGNVKAAGASDVVLYKIDVPANRYDLLCLEGLVRGLQVFKERIKAPVYKRVMPDGKIQKLIITEETAKIRPFAVAAVLRNIKFTKDRYDSFIELQEKL |
Gene ID - Mouse | ENSMUSG00000026245 |
Gene ID - Rat | ENSRNOG00000014119 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FARSB pAb (ATL-HPA036677) | |
Datasheet | Anti FARSB pAb (ATL-HPA036677) Datasheet (External Link) |
Vendor Page | Anti FARSB pAb (ATL-HPA036677) at Atlas Antibodies |
Documents & Links for Anti FARSB pAb (ATL-HPA036677) | |
Datasheet | Anti FARSB pAb (ATL-HPA036677) Datasheet (External Link) |
Vendor Page | Anti FARSB pAb (ATL-HPA036677) |