Anti FARS2 pAb (ATL-HPA018148 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA018148-100
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FARS2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416556).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: phenylalanyl-tRNA synthetase 2, mitochondrial
Gene Name: FARS2
Alternative Gene Name: dJ236A3.1, FARS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021420: 92%, ENSRNOG00000016135: 94%
Entrez Gene ID: 10667
Uniprot ID: O95363
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTPLFSVYDNLSPVVTTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKHELFAGIKDGES
Gene Sequence GTPLFSVYDNLSPVVTTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKHELFAGIKDGES
Gene ID - Mouse ENSMUSG00000021420
Gene ID - Rat ENSRNOG00000016135
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FARS2 pAb (ATL-HPA018148 w/enhanced validation)
Datasheet Anti FARS2 pAb (ATL-HPA018148 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FARS2 pAb (ATL-HPA018148 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FARS2 pAb (ATL-HPA018148 w/enhanced validation)
Datasheet Anti FARS2 pAb (ATL-HPA018148 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FARS2 pAb (ATL-HPA018148 w/enhanced validation)