Anti FANCL pAb (ATL-HPA036686)

Atlas Antibodies

Catalog No.:
ATL-HPA036686-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Fanconi anemia, complementation group L
Gene Name: FANCL
Alternative Gene Name: FAAP43, FLJ10335, PHF9, Pog
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004018: 82%, ENSRNOG00000027249: 80%
Entrez Gene ID: 55120
Uniprot ID: Q9NW38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPIT
Gene Sequence FPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPIT
Gene ID - Mouse ENSMUSG00000004018
Gene ID - Rat ENSRNOG00000027249
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FANCL pAb (ATL-HPA036686)
Datasheet Anti FANCL pAb (ATL-HPA036686) Datasheet (External Link)
Vendor Page Anti FANCL pAb (ATL-HPA036686) at Atlas Antibodies

Documents & Links for Anti FANCL pAb (ATL-HPA036686)
Datasheet Anti FANCL pAb (ATL-HPA036686) Datasheet (External Link)
Vendor Page Anti FANCL pAb (ATL-HPA036686)