Anti FANCG pAb (ATL-HPA045335)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045335-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FANCG
Alternative Gene Name: FAG, XRCC9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028453: 72%, ENSRNOG00000057945: 71%
Entrez Gene ID: 2189
Uniprot ID: O15287
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLLLKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLCPRPVLVQVYTALGSCHRKMG |
Gene Sequence | DSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLLLKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLCPRPVLVQVYTALGSCHRKMG |
Gene ID - Mouse | ENSMUSG00000028453 |
Gene ID - Rat | ENSRNOG00000057945 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FANCG pAb (ATL-HPA045335) | |
Datasheet | Anti FANCG pAb (ATL-HPA045335) Datasheet (External Link) |
Vendor Page | Anti FANCG pAb (ATL-HPA045335) at Atlas Antibodies |
Documents & Links for Anti FANCG pAb (ATL-HPA045335) | |
Datasheet | Anti FANCG pAb (ATL-HPA045335) Datasheet (External Link) |
Vendor Page | Anti FANCG pAb (ATL-HPA045335) |