Anti FANCG pAb (ATL-HPA045335)

Atlas Antibodies

Catalog No.:
ATL-HPA045335-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: Fanconi anemia, complementation group G
Gene Name: FANCG
Alternative Gene Name: FAG, XRCC9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028453: 72%, ENSRNOG00000057945: 71%
Entrez Gene ID: 2189
Uniprot ID: O15287
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLLLKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLCPRPVLVQVYTALGSCHRKMG
Gene Sequence DSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLLLKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLCPRPVLVQVYTALGSCHRKMG
Gene ID - Mouse ENSMUSG00000028453
Gene ID - Rat ENSRNOG00000057945
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FANCG pAb (ATL-HPA045335)
Datasheet Anti FANCG pAb (ATL-HPA045335) Datasheet (External Link)
Vendor Page Anti FANCG pAb (ATL-HPA045335) at Atlas Antibodies

Documents & Links for Anti FANCG pAb (ATL-HPA045335)
Datasheet Anti FANCG pAb (ATL-HPA045335) Datasheet (External Link)
Vendor Page Anti FANCG pAb (ATL-HPA045335)