Anti FAM9B pAb (ATL-HPA035135 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA035135-25

• 
• 
• 

Protein Description: family with sequence similarity 9, member B
Gene Name: FAM9B
Alternative Gene Name: TEX39B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020059: 44%, ENSRNOG00000005270: 45%
Entrez Gene ID: 171483
Uniprot ID: Q8IZU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEEEGEEEELIRIFQEQQKKWQQYRSVRRERLKEMKLLRDQFVKALEDFEDLCDRVFSDEDSEL
• Gene Sequence: EEEEGEEEELIRIFQEQQKKWQQYRSVRRERLKEMKLLRDQFVKALEDFEDLCDRVFSDEDSEL
• Gene ID - Mouse: ENSMUSG00000020059
• Gene ID - Rat: ENSRNOG00000005270
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.