Anti FAM98A pAb (ATL-HPA036251)

Atlas Antibodies

SKU:
ATL-HPA036251-100
  • Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 98, member A
Gene Name: FAM98A
Alternative Gene Name: DKFZP564F0522
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002017: 100%, ENSRNOG00000030328: 100%
Entrez Gene ID: 25940
Uniprot ID: Q8NCA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLTYLISELEAARMLCVNAPPKKAQEGGGSEVFQELKGICIALGMSKPPANITMFQFFSGIEKKLKETLAKVPPNH
Gene Sequence LLTYLISELEAARMLCVNAPPKKAQEGGGSEVFQELKGICIALGMSKPPANITMFQFFSGIEKKLKETLAKVPPNH
Gene ID - Mouse ENSMUSG00000002017
Gene ID - Rat ENSRNOG00000030328
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM98A pAb (ATL-HPA036251)
Datasheet Anti FAM98A pAb (ATL-HPA036251) Datasheet (External Link)
Vendor Page Anti FAM98A pAb (ATL-HPA036251) at Atlas Antibodies

Documents & Links for Anti FAM98A pAb (ATL-HPA036251)
Datasheet Anti FAM98A pAb (ATL-HPA036251) Datasheet (External Link)
Vendor Page Anti FAM98A pAb (ATL-HPA036251)



!