Anti FAM98A pAb (ATL-HPA036250)

Atlas Antibodies

SKU: ATL-HPA036250-25

• 
• 
• 

Protein Description: family with sequence similarity 98, member A
Gene Name: FAM98A
Alternative Gene Name: DKFZP564F0522
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002017: 93%, ENSRNOG00000030328: 93%
Entrez Gene ID: 25940
Uniprot ID: Q8NCA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCL
• Gene Sequence: PLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCL
• Gene ID - Mouse: ENSMUSG00000002017
• Gene ID - Rat: ENSRNOG00000030328
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.