Anti FAM98A pAb (ATL-HPA036250)

Atlas Antibodies

Catalog No.:
ATL-HPA036250-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 98, member A
Gene Name: FAM98A
Alternative Gene Name: DKFZP564F0522
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002017: 93%, ENSRNOG00000030328: 93%
Entrez Gene ID: 25940
Uniprot ID: Q8NCA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCL
Gene Sequence PLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCL
Gene ID - Mouse ENSMUSG00000002017
Gene ID - Rat ENSRNOG00000030328
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM98A pAb (ATL-HPA036250)
Datasheet Anti FAM98A pAb (ATL-HPA036250) Datasheet (External Link)
Vendor Page Anti FAM98A pAb (ATL-HPA036250) at Atlas Antibodies

Documents & Links for Anti FAM98A pAb (ATL-HPA036250)
Datasheet Anti FAM98A pAb (ATL-HPA036250) Datasheet (External Link)
Vendor Page Anti FAM98A pAb (ATL-HPA036250)