Anti FAM98A pAb (ATL-HPA036250)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036250-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FAM98A
Alternative Gene Name: DKFZP564F0522
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002017: 93%, ENSRNOG00000030328: 93%
Entrez Gene ID: 25940
Uniprot ID: Q8NCA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCL |
Gene Sequence | PLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCL |
Gene ID - Mouse | ENSMUSG00000002017 |
Gene ID - Rat | ENSRNOG00000030328 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAM98A pAb (ATL-HPA036250) | |
Datasheet | Anti FAM98A pAb (ATL-HPA036250) Datasheet (External Link) |
Vendor Page | Anti FAM98A pAb (ATL-HPA036250) at Atlas Antibodies |
Documents & Links for Anti FAM98A pAb (ATL-HPA036250) | |
Datasheet | Anti FAM98A pAb (ATL-HPA036250) Datasheet (External Link) |
Vendor Page | Anti FAM98A pAb (ATL-HPA036250) |