Anti FAM91A1 pAb (ATL-HPA027978)

Atlas Antibodies

Catalog No.: ATL-HPA027978-25

Protein Description: family with sequence similarity 91, member A1
Gene Name: FAM91A1
Alternative Gene Name: FLJ23790
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037119: 88%, ENSRNOG00000008271: 88%
Entrez Gene ID: 157769
Uniprot ID: Q658Y4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHGIGETVHVPFPFDETELQGEFTRVNMGVHKALQILRNRVDLQHLCGYVTMLNASSQLADRKLSDASDERGEPDLASGS
• Gene Sequence: LHGIGETVHVPFPFDETELQGEFTRVNMGVHKALQILRNRVDLQHLCGYVTMLNASSQLADRKLSDASDERGEPDLASGS
• Gene ID - Mouse: ENSMUSG00000037119
• Gene ID - Rat: ENSRNOG00000008271
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.