Anti FAM91A1 pAb (ATL-HPA027978)

Atlas Antibodies

SKU:
ATL-HPA027978-25
  • Immunohistochemical staining of human nasopharynx shows strong cytoplasmic positivity in respiratory epithelial cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & microtubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 91, member A1
Gene Name: FAM91A1
Alternative Gene Name: FLJ23790
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037119: 88%, ENSRNOG00000008271: 88%
Entrez Gene ID: 157769
Uniprot ID: Q658Y4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHGIGETVHVPFPFDETELQGEFTRVNMGVHKALQILRNRVDLQHLCGYVTMLNASSQLADRKLSDASDERGEPDLASGS
Gene Sequence LHGIGETVHVPFPFDETELQGEFTRVNMGVHKALQILRNRVDLQHLCGYVTMLNASSQLADRKLSDASDERGEPDLASGS
Gene ID - Mouse ENSMUSG00000037119
Gene ID - Rat ENSRNOG00000008271
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM91A1 pAb (ATL-HPA027978)
Datasheet Anti FAM91A1 pAb (ATL-HPA027978) Datasheet (External Link)
Vendor Page Anti FAM91A1 pAb (ATL-HPA027978) at Atlas Antibodies

Documents & Links for Anti FAM91A1 pAb (ATL-HPA027978)
Datasheet Anti FAM91A1 pAb (ATL-HPA027978) Datasheet (External Link)
Vendor Page Anti FAM91A1 pAb (ATL-HPA027978)