Anti FAM89B pAb (ATL-HPA046895)

Atlas Antibodies

Catalog No.:
ATL-HPA046895-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 89, member B
Gene Name: FAM89B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024939: 98%, ENSRNOG00000024239: 89%
Entrez Gene ID: 23625
Uniprot ID: Q8N5H3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKEMLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLS
Gene Sequence RKEMLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLS
Gene ID - Mouse ENSMUSG00000024939
Gene ID - Rat ENSRNOG00000024239
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM89B pAb (ATL-HPA046895)
Datasheet Anti FAM89B pAb (ATL-HPA046895) Datasheet (External Link)
Vendor Page Anti FAM89B pAb (ATL-HPA046895) at Atlas Antibodies

Documents & Links for Anti FAM89B pAb (ATL-HPA046895)
Datasheet Anti FAM89B pAb (ATL-HPA046895) Datasheet (External Link)
Vendor Page Anti FAM89B pAb (ATL-HPA046895)