Anti FAM89B pAb (ATL-HPA046895)

Atlas Antibodies

Catalog No.: ATL-HPA046895-100

Protein Description: family with sequence similarity 89, member B
Gene Name: FAM89B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024939: 98%, ENSRNOG00000024239: 89%
Entrez Gene ID: 23625
Uniprot ID: Q8N5H3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKEMLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLS
• Gene Sequence: RKEMLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLS
• Gene ID - Mouse: ENSMUSG00000024939
• Gene ID - Rat: ENSRNOG00000024239
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.