Anti FAM72A pAb (ATL-HPA043271)

Atlas Antibodies

SKU:
ATL-HPA043271-25
  • Immunohistochemical staining of human soft tissue shows moderate cytoplasmic positivity in peripheral nerve.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 72, member A
Gene Name: FAM72A
Alternative Gene Name: MGC57827, RP11-312O7.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055184: 94%, ENSRNOG00000042747: 92%
Entrez Gene ID: 729533
Uniprot ID: Q5TYM5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFT
Gene Sequence CVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFT
Gene ID - Mouse ENSMUSG00000055184
Gene ID - Rat ENSRNOG00000042747
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM72A pAb (ATL-HPA043271)
Datasheet Anti FAM72A pAb (ATL-HPA043271) Datasheet (External Link)
Vendor Page Anti FAM72A pAb (ATL-HPA043271) at Atlas Antibodies

Documents & Links for Anti FAM72A pAb (ATL-HPA043271)
Datasheet Anti FAM72A pAb (ATL-HPA043271) Datasheet (External Link)
Vendor Page Anti FAM72A pAb (ATL-HPA043271)