Anti FAM43B pAb (ATL-HPA050813)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050813-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FAM43B
Alternative Gene Name: FLJ44952
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078235: 99%, ENSRNOG00000043113: 99%
Entrez Gene ID: 163933
Uniprot ID: Q6ZT52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDPTYTVWY |
| Gene Sequence | PWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDPTYTVWY |
| Gene ID - Mouse | ENSMUSG00000078235 |
| Gene ID - Rat | ENSRNOG00000043113 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM43B pAb (ATL-HPA050813) | |
| Datasheet | Anti FAM43B pAb (ATL-HPA050813) Datasheet (External Link) |
| Vendor Page | Anti FAM43B pAb (ATL-HPA050813) at Atlas Antibodies |
| Documents & Links for Anti FAM43B pAb (ATL-HPA050813) | |
| Datasheet | Anti FAM43B pAb (ATL-HPA050813) Datasheet (External Link) |
| Vendor Page | Anti FAM43B pAb (ATL-HPA050813) |