Anti FAM43B pAb (ATL-HPA050813)

Atlas Antibodies

Catalog No.:
ATL-HPA050813-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 43, member B
Gene Name: FAM43B
Alternative Gene Name: FLJ44952
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078235: 99%, ENSRNOG00000043113: 99%
Entrez Gene ID: 163933
Uniprot ID: Q6ZT52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDPTYTVWY
Gene Sequence PWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDPTYTVWY
Gene ID - Mouse ENSMUSG00000078235
Gene ID - Rat ENSRNOG00000043113
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM43B pAb (ATL-HPA050813)
Datasheet Anti FAM43B pAb (ATL-HPA050813) Datasheet (External Link)
Vendor Page Anti FAM43B pAb (ATL-HPA050813) at Atlas Antibodies

Documents & Links for Anti FAM43B pAb (ATL-HPA050813)
Datasheet Anti FAM43B pAb (ATL-HPA050813) Datasheet (External Link)
Vendor Page Anti FAM43B pAb (ATL-HPA050813)