Anti FAM3C pAb (ATL-HPA043376)

Atlas Antibodies

Catalog No.:
ATL-HPA043376-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 3, member C
Gene Name: FAM3C
Alternative Gene Name: GS3876, ILEI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029672: 96%, ENSRNOG00000060349: 94%
Entrez Gene ID: 10447
Uniprot ID: Q92520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVV
Gene Sequence MDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVV
Gene ID - Mouse ENSMUSG00000029672
Gene ID - Rat ENSRNOG00000060349
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM3C pAb (ATL-HPA043376)
Datasheet Anti FAM3C pAb (ATL-HPA043376) Datasheet (External Link)
Vendor Page Anti FAM3C pAb (ATL-HPA043376) at Atlas Antibodies

Documents & Links for Anti FAM3C pAb (ATL-HPA043376)
Datasheet Anti FAM3C pAb (ATL-HPA043376) Datasheet (External Link)
Vendor Page Anti FAM3C pAb (ATL-HPA043376)