Anti FAM26E pAb (ATL-HPA034970)

Atlas Antibodies

Catalog No.:
ATL-HPA034970-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 26, member E
Gene Name: FAM26E
Alternative Gene Name: C6orf188, dJ493F7.3, MGC45451
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049872: 74%, ENSRNOG00000000825: 77%
Entrez Gene ID: 254228
Uniprot ID: Q8N5C1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YAQKEKEQLENTFLDYANKLSERNLKCFFENKRPDPFPMPTFAAWEAASELHSFHQSQQHYSTLHRVVDNGLQLSPEDDETTMVLVGTAHNM
Gene Sequence YAQKEKEQLENTFLDYANKLSERNLKCFFENKRPDPFPMPTFAAWEAASELHSFHQSQQHYSTLHRVVDNGLQLSPEDDETTMVLVGTAHNM
Gene ID - Mouse ENSMUSG00000049872
Gene ID - Rat ENSRNOG00000000825
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM26E pAb (ATL-HPA034970)
Datasheet Anti FAM26E pAb (ATL-HPA034970) Datasheet (External Link)
Vendor Page Anti FAM26E pAb (ATL-HPA034970) at Atlas Antibodies

Documents & Links for Anti FAM26E pAb (ATL-HPA034970)
Datasheet Anti FAM26E pAb (ATL-HPA034970) Datasheet (External Link)
Vendor Page Anti FAM26E pAb (ATL-HPA034970)