Anti FAM26E pAb (ATL-HPA034969)

Atlas Antibodies

SKU: ATL-HPA034969-25

• 

Protein Description: family with sequence similarity 26, member E
Gene Name: FAM26E
Alternative Gene Name: C6orf188, dJ493F7.3, MGC45451
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049872: 79%, ENSRNOG00000000825: 79%
Entrez Gene ID: 254228
Uniprot ID: Q8N5C1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YECAMSGTRSSGLLELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQA
• Gene Sequence: YECAMSGTRSSGLLELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQA
• Gene ID - Mouse: ENSMUSG00000049872
• Gene ID - Rat: ENSRNOG00000000825
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.