Anti FAM26E pAb (ATL-HPA034969)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034969-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FAM26E
Alternative Gene Name: C6orf188, dJ493F7.3, MGC45451
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049872: 79%, ENSRNOG00000000825: 79%
Entrez Gene ID: 254228
Uniprot ID: Q8N5C1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YECAMSGTRSSGLLELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQA |
| Gene Sequence | YECAMSGTRSSGLLELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQA |
| Gene ID - Mouse | ENSMUSG00000049872 |
| Gene ID - Rat | ENSRNOG00000000825 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM26E pAb (ATL-HPA034969) | |
| Datasheet | Anti FAM26E pAb (ATL-HPA034969) Datasheet (External Link) |
| Vendor Page | Anti FAM26E pAb (ATL-HPA034969) at Atlas Antibodies |
| Documents & Links for Anti FAM26E pAb (ATL-HPA034969) | |
| Datasheet | Anti FAM26E pAb (ATL-HPA034969) Datasheet (External Link) |
| Vendor Page | Anti FAM26E pAb (ATL-HPA034969) |