Anti FAM234B pAb (ATL-HPA010850)

Atlas Antibodies

SKU: ATL-HPA010850-25

• 

Protein Description: family with sequence similarity 234 member B
Gene Name: FAM234B
Alternative Gene Name: KIAA1467
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030207: 83%, ENSRNOG00000008443: 83%
Entrez Gene ID: 57613
Uniprot ID: A2RU67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLSPLELADVNGDGLRDVLLSFVMSRNGSAVGVSRPAANLVCLSGMNGSTLWSSLLPEEARDITCLELMPGSLAETICLVTGTHKMLSAFNATSGKAIWTLNPNYLSNGTLAAPVVVLPDLDEDGVR
• Gene Sequence: DLSPLELADVNGDGLRDVLLSFVMSRNGSAVGVSRPAANLVCLSGMNGSTLWSSLLPEEARDITCLELMPGSLAETICLVTGTHKMLSAFNATSGKAIWTLNPNYLSNGTLAAPVVVLPDLDEDGVR
• Gene ID - Mouse: ENSMUSG00000030207
• Gene ID - Rat: ENSRNOG00000008443
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.