Anti FAM222A pAb (ATL-HPA040181)

Atlas Antibodies

SKU:
ATL-HPA040181-25
  • Immunohistochemical staining of human stomach shows strong membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane, mitochondria & focal adhesion sites.
  • Western blot analysis in human cell line SH-SY5Y.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 222, member A
Gene Name: FAM222A
Alternative Gene Name: C12orf34, FLJ14721
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041930: 88%, ENSRNOG00000001198: 85%
Entrez Gene ID: 84915
Uniprot ID: Q5U5X8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSIHSLLYQLNQQCQAPGAAPPACQGMAIPHPSPAKHGPVPSFPSMAYSAAAGLPDCRKGTELGQGATQALTLAGAAKPAGYADSGLDYLLWPQKP
Gene Sequence PSIHSLLYQLNQQCQAPGAAPPACQGMAIPHPSPAKHGPVPSFPSMAYSAAAGLPDCRKGTELGQGATQALTLAGAAKPAGYADSGLDYLLWPQKP
Gene ID - Mouse ENSMUSG00000041930
Gene ID - Rat ENSRNOG00000001198
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM222A pAb (ATL-HPA040181)
Datasheet Anti FAM222A pAb (ATL-HPA040181) Datasheet (External Link)
Vendor Page Anti FAM222A pAb (ATL-HPA040181) at Atlas Antibodies

Documents & Links for Anti FAM222A pAb (ATL-HPA040181)
Datasheet Anti FAM222A pAb (ATL-HPA040181) Datasheet (External Link)
Vendor Page Anti FAM222A pAb (ATL-HPA040181)